PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g50166.1.p
Common NameBRADI_3g50166, LOC100829110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family DBB
Protein Properties Length: 262aa    MW: 27973 Da    PI: 5.8341
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g50166.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box193e-06443538
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                       C+ +    ++ fC  ++  lC+ C    H+       H+
  Bradi3g50166.1.p  4 QCDVCAADAASVFCCADEAALCDACDRRVHRAnklagkHR 43
                      7******99*********************7677777776 PP

2zf-B_box25.33.1e-086193335
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                      ++ C+ ++ek+  lfC++++  lC++C +  H 
  Bradi3g50166.1.p 61 PPLCDICQEKRGFLFCKEDRAILCRECDVPVHA 93
                      789*************************99883 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.57147IPR000315B-box-type zinc finger
SMARTSM003369.1E-9147IPR000315B-box-type zinc finger
CDDcd000217.14E-6347No hitNo description
PROSITE profilePS501199.48559106IPR000315B-box-type zinc finger
SMARTSM003362.9E-1259106IPR000315B-box-type zinc finger
PfamPF006435.6E-760102IPR000315B-box-type zinc finger
CDDcd000214.70E-863106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MKVQCDVCAA DAASVFCCAD EAALCDACDR RVHRANKLAG KHRRFSLLNA SPSASSASSP  60
PPLCDICQEK RGFLFCKEDR AILCRECDVP VHAVSDLTMR HTRFLLTGVR ISSEPAASPA  120
PPSDQEENNA DYCCSGDNAA TSHGCGSSTS SSISEYLTKT LPGWHVEDFL VDDATAAAAA  180
AASSSSTGIS AHGSYSYQGE TRNSGMHEAG YASWMAQERP FCDSVDVGTL AMSNRERWVP  240
QMYAEPAGSK RSRTSAAYPY W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572759.10.0PREDICTED: B-box zinc finger protein 20-like
SwissprotQ9LQZ73e-52BBX21_ARATH; B-box zinc finger protein 21
TrEMBLI1IC250.0I1IC25_BRADI; Uncharacterized protein
STRINGBRADI3G50166.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23923679
Representative plantOGRP29841130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.13e-34salt tolerance homolog2